Description
Overview
LL-37 is the only human cathelicidin-derived host-defense peptide, a 37-amino-acid cationic peptide released from the C-terminal domain of the hCAP-18 precursor protein (the CAMP gene product). Its name reflects its two N-terminal leucine residues and its 37-residue length. In preclinical research it has been studied as an amphipathic, alpha-helical peptide with roles in host defense, immune modulation, wound repair, and angiogenesis. It is also referred to in the literature as CAP-18 or hCAP-18/LL-37.
Structure & Chemistry
- Molecular formula: C₂₀₅H₃₄₀N₆₀O₅₃
- Molecular weight: 4493 g/mol
- Class: 37-residue cationic, amphipathic alpha-helical peptide (cathelicidin family)
- Sequence: [LL-37, 37 aa]
Regulatory & Research Status
- Not approved by the FDA for any therapeutic use.
- Findings are drawn from laboratory and preclinical studies; human clinical confirmation is limited.
Specifications
| Presentation | 5 mg lyophilized peptide, single vial |
|---|---|
| Purity | >99% by HPLC |
| Form | Lyophilized powder (reconstitute with bacteriostatic water for laboratory use) |
| Category | Host-defense / antimicrobial peptide research |
For laboratory and research use only. Not for human or animal consumption. Not approved by the FDA for any therapeutic use. No claims regarding therapeutic efficacy are made or implied. Must be 21 or older.
Reviews
There are no reviews yet.